A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10069
Swiss-prot Accession number	Q8UW80 (Sequence in FASTA format)
Description	Progonadoliberin-1 precursor (Progonadoliberin I) (Seabream-typegonadotropin-releasing hormone) (SbGnRH) [Contains: Gonadoliberin-1(Gonadoliberin I) (Luteinizing hormone-releasing hormone I) (LH-RH I)(Gonadotropin-releasing hormone I) (GnRH-I) (Luliberin I); GnRH-associated peptide 1 (GnRH-associated peptide I)].
Source organism	Verasper moseri (Barfin flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Verasper.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	Preoptic area of the brain
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	96 Amino acids
Molecular weight	10560
References	1  PubMed abstract 12093120
Domain Name	N/A
Hormone Name	Gonadoliberin-1
Mature Hormone Sequence	QHWSYGLSPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (27-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10070
Swiss-prot Accession number	Q8UW81 (Sequence in FASTA format)
Description	Progonadoliberin-2 precursor (Progonadoliberin II) (Chicken-type IIgonadotropin-releasing hormone) (cGnRH-II) [Contains: Gonadoliberin-2(Gonadoliberin II) (Luteinizing hormone-releasing hormone II) (LH-RHII) (Gonadotropin-releasing hormone II) (GnRH-II) (Luliberin II);GnRH-associated peptide 2 (GnRH-associated peptide II)].
Source organism	Verasper moseri (Barfin flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Verasper.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	Midbrain tegmentum
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	85 Amino acids
Molecular weight	9593
References	1  PubMed abstract 12093120
Domain Name	N/A
Hormone Name	Gonadoliberin-2
Mature Hormone Sequence	QHWSHGWYPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (24-33)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10071
Swiss-prot Accession number	Q8UW82 (Sequence in FASTA format)
Description	Progonadoliberin-3 precursor (Progonadoliberin III) (Salmon-typegonadotropin-releasing hormone) (sGnRH) [Contains: Gonadoliberin-3(Gonadoliberin III) (Luteinizing hormone-releasing hormone III) (LH-RHIII) (Gonadotropin-releasing hormone III) (GnRH III) (Luliberin III);GnRH-associated peptide 3 (GnRH-associated peptide III)].
Source organism	Verasper moseri (Barfin flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Verasper.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the GnRH family.
Tissue Specificity	Brain; ventromedial olfactory bulbs and terminal nerve ganglion
Post translational modification	N/A
Function	Stimulates the secretion of gonadotropins
Protein Length	90 Amino acids
Molecular weight	10090
References	1  PubMed abstract 12093120
Domain Name	N/A
Hormone Name	Gonadoliberin-3
Mature Hormone Sequence	QHWSYGWLPG
Position of mature hormone in Pre-Hormone protein	10 Residues from position (24-33)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10187
Swiss-prot Accession number	Q9W7R2 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Verasper moseri (Barfin flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Verasper.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	115 Amino acids
Molecular weight	12608
References	1   Andoh T., Nagasawa H.; "Two molecular forms of insulin from barfin flounder, Verasper moseri,are derived from a single gene."; Zool. Sci. 15:931-937(1998).
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	QAVLPPQHLCGAHLVDALYLVCGERGFFYTP
Position of mature hormone in Pre-Hormone protein	31 Residues from position (23-53)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10905
Swiss-prot Accession number	Q9W7R2 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Verasper moseri (Barfin flounder)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Pleuronectiformes;Pleuronectoidei; Pleuronectidae; Verasper.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	115 Amino acids
Molecular weight	12608
References	1   Andoh T., Nagasawa H.; "Two molecular forms of insulin from barfin flounder, Verasper moseri,are derived from a single gene."; Zool. Sci. 15:931-937(1998).
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHKPCNIFDLQNYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (95-115)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated